Mouse Anti-Rhesus GNMT Antibody (CBMOAB-43783FYA)
Cat: CBMOAB-43783FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO43783FYA |
Specificity | This antibody binds to Rhesus GNMT. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644. |
Product Overview | Mouse Anti-Rhesus GNMT Antibody is a mouse antibody against GNMT. It can be used for GNMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glycine N-methyltransferase; GNMT |
UniProt ID | H9F474 |
Protein Refseq | The length of the protein is 89 amino acids long. The sequence is show below: TSVLIVNNKVHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQAYVPCYFIHVLKRTD. |
See other products for " GNMT "
MO-AB-00565L | Mouse Anti-Elephant GNMT Antibody (MO-AB-00565L) |
MO-AB-56150W | Mouse Anti-Marmoset GNMT Antibody (MO-AB-56150W) |
CBMOAB-17926FYA | Mouse Anti-D. melanogaster Gnmt Antibody (CBMOAB-17926FYA) |
CBMOAB-78220FYA | Mouse Anti-Zebrafish gnmt Antibody (CBMOAB-78220FYA) |
MO-AB-26161R | Mouse Anti-Pig GNMT Antibody (MO-AB-26161R) |
MO-AB-08237Y | Mouse Anti-Rabbit GNMT Antibody (MO-AB-08237Y) |
MO-AB-25953W | Mouse Anti-Chimpanzee GNMT Antibody (MO-AB-25953W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry