Mouse Anti-Rhesus GNMT Antibody (CBMOAB-43783FYA)


Cat: CBMOAB-43783FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO43783FYA
SpecificityThis antibody binds to Rhesus GNMT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an enzyme that catalyzes the conversion of S-adenosyl-L-methionine (along with glycine) to S-adenosyl-L-homocysteine and sarcosine. This protein is found in the cytoplasm and acts as a homotetramer. Defects in this gene are a cause of GNMT deficiency (hypermethioninemia). Alternative splicing results in multiple transcript variants. Naturally occurring readthrough transcription occurs between the upstream CNPY3 (canopy FGF signaling regulator 3) gene and this gene and is represented with GeneID:107080644.
Product OverviewMouse Anti-Rhesus GNMT Antibody is a mouse antibody against GNMT. It can be used for GNMT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycine N-methyltransferase; GNMT
UniProt IDH9F474
Protein RefseqThe length of the protein is 89 amino acids long.
The sequence is show below: TSVLIVNNKVHMVTLDYTVQVPGAGQDGSPGLSKFRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQAYVPCYFIHVLKRTD.
For Research Use Only | Not For Clinical Use.
Online Inquiry