Mouse Anti-Chimpanzee HMGB3 Antibody (MO-AB-12423W)


Cat: MO-AB-12423W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO12423W
SpecificityThis antibody binds to Chimpanzee HMGB3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Chimpanzee HMGB3 Antibody is a mouse antibody against HMGB3. It can be used for HMGB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHigh mobility group box 3; HMGB3
UniProt IDK7AE28
Protein RefseqThe length of the protein is 213 amino acids long.
The sequence is show below: MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMKDYGPAKGGKKKKDPSAPKRPPSGFFLFSSEIRPKIKSTNPGISVGDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEEEDEEEEEEEEEEGRRRMNKETVYLSPCEYLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry