Mouse Anti-Frog hmgb3 Antibody (MO-AB-04279H)


Cat: MO-AB-04279H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO04279C
SpecificityThis antibody binds to Frog hmgb3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against hmgb3. It can be used for hmgb3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHmgb3-prov protein; hmgb3
UniProt IDQ7ZY24
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MAKGDPKKPKGKMSAYAYFVQTCREEHKKKNPEIPVNFSEFSKKCSERWRGMSGKEKSKFDDLAKADKVRYDREMQDFGPVKKGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGITIGDVAKKLGEMWNNLSDSEKQPYNNKGAKLKEKYEKDVADYKSKGKFDGAKAAPKLARKKEEDDDDDDEEDEEEDEEDEDDDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry