Mouse Anti-Chimpanzee SCP2 Antibody (MO-AB-24774W)
Cat: MO-AB-24774W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO24774W |
Specificity | This antibody binds to Chimpanzee SCP2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Peroxisome; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. |
Product Overview | Mouse Anti-Chimpanzee SCP2 Antibody is a mouse antibody against SCP2. It can be used for SCP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sterol carrier protein 2; SCP2 |
UniProt ID | H2PZ17 |
Protein Refseq | The length of the protein is 547 amino acids long. The sequence is show below: MSSSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQIPYSAVDQACVGYVFGDSTCGQRAIYHSLGMTGIPIINVNNNCATGSTALFMARQLIQGGVAECVLALGFEKMSKGSLGIKFSDRTIPTDKHVDLLINKYGLSAHPVAPQMFGYAGKEHMEKYGTKIEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILASEAFLQKYGLQSKAVEILAQEMMTDLPSSFEEKSIIKMVGFDMSKEAARKCYEKSGLTPNDIDVIELHDCFSTNELLTYEALGLCPEGQGATLVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGIGGAVVVTLYKMGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQSLQLQPGNAKL. |
See other products for " SCP2 "
MO-AB-19818R | Mouse Anti-Cattle SCP2 Antibody (MO-AB-19818R) |
CBMOAB-41125FYC | Mouse Anti-Arabidopsis SCP2 Antibody (CBMOAB-41125FYC) |
CBMOAB-57261FYA | Mouse Anti-Rhesus SCP2 Antibody (CBMOAB-57261FYA) |
MO-AB-03910Y | Mouse Anti-Chicken SCP2 Antibody (MO-AB-03910Y) |
MO-AB-63963W | Mouse Anti-Marmoset SCP2 Antibody (MO-AB-63963W) |
MO-AB-09855Y | Mouse Anti-Rabbit SCP2 Antibody (MO-AB-09855Y) |
CBMOAB-30443FYA | Mouse Anti-D. melanogaster Scp2 Antibody (CBMOAB-30443FYA) |
MO-AB-07461H | Mouse Anti-Frog scp2 Antibody (MO-AB-07461H) |
MO-AB-29006R | Mouse Anti-Pig SCP2 Antibody (MO-AB-29006R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry