Mouse Anti-Chimpanzee TH Antibody (MO-AB-27016W)
Cat: MO-AB-27016W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO27016W |
Specificity | This antibody binds to Chimpanzee TH. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Product Overview | Mouse Anti-Chimpanzee TH Antibody is a mouse antibody against TH. It can be used for TH detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Tyrosine hydroxylase; TH |
UniProt ID | Q8HZ55 |
Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: SYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG. |
See other products for " TH "
MO-AB-46795W | Mouse Anti-Horse TH Antibody (MO-AB-46795W) |
MO-AB-01751R | Mouse Anti-Medaka th Antibody (MO-AB-01751R) |
CBMOAB-60135FYA | Mouse Anti-Rhesus TH Antibody (CBMOAB-60135FYA) |
MO-DKB-00460W | Rabbit Anti-TH Antibody (MO-DKB-00460W) |
MOFY-1222-FY255 | Mouse Anti-th Antibody (MOFY-1222-FY255) |
MO-AB-08404H | Mouse Anti-Frog th Antibody (MO-AB-08404H) |
MO-AB-29437H | Mouse Anti-Rat Th Antibody (MO-AB-29437H) |
MO-AB-33709W | Mouse Anti-Dog TH Antibody (MO-AB-33709W) |
MOFAB-796W | Mouse Anti-TH Antibody (MOFAB-796W) |
CBMOAB-32957FYA | Mouse Anti-D. melanogaster Th Antibody (CBMOAB-32957FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry