Mouse Anti-Chimpanzee TH Antibody (MO-AB-27016W)


Cat: MO-AB-27016W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO27016W
SpecificityThis antibody binds to Chimpanzee TH.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product OverviewMouse Anti-Chimpanzee TH Antibody is a mouse antibody against TH. It can be used for TH detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTyrosine hydroxylase; TH
UniProt IDQ8HZ55
Protein RefseqThe length of the protein is 52 amino acids long.
The sequence is show below: SYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry