AibGenesis™ Mouse Anti-chst10 Antibody (CBMOAB-70497FYA)


Cat: CBMOAB-70497FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70497FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa) WB, ELISA MO70497FYA 100 µg
MO-AB-01199Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01199Y 100 µg
MO-AB-10219R Monoclonal Cattle (Bos taurus) WB, ELISA MO10219R 100 µg
MO-AB-18590W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18590W 100 µg
MO-AB-24600R Monoclonal Pig (Sus scrofa) WB, ELISA MO24600R 100 µg
MO-AB-52999W Monoclonal Marmoset WB, ELISA MO52999W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa)
CloneMO70497FYA
SpecificityThis antibody binds to Zebrafish chst10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCatalyzes the transfer of sulfate to position 3 of terminal glucuronic acid of both protein- and lipid-linked oligosaccharides. Participates in biosynthesis of HNK-1 carbohydrate structure, a sulfated glucuronyl-lactosaminyl residue carried by many neural recognition molecules. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish chst10 Antibody is a mouse antibody against chst10. It can be used for chst10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCarbohydrate sulfotransferase 10; EC 2.8.2.-; HNK-1 sulfotransferase; HNK-1ST; HNK1ST; chst1
UniProt IDQ6AXM1
Protein RefseqThe length of the protein is 365 amino acids long.
The sequence is show below: MRRHWLLVGACGWVLLILMFVSKFINFSFRIPGDYAGRSEIFVWTLSSVTTKLPSVVWPEKGASQPYILSSVSPSVVEPIDWHLVNEKRLEQLSTVCSNSSIWNLTHTTVRKFVLDRIFVCDKHKILFCQTPKVGNTQWKKVLIVLNGKFSKVEAIPENLVHDHERNGLPRLSSMTDTEIHQRLNSYFKFFIVRDPFERLISAFKDKFVKNPRFEPWYKHDIAPAIVRKYRRSHHDDSESVGLRFEDFVRYLGDKTGRQHLDRQFGDHIIHWLTYAELCAPCDISYNVVGHHETLELDAPYILKSAGIAGLVSYPSIPPGITRYNRTKVERYFSGISQRDIRRLYARYQGDFSLFDYPKPAFLLN.
For Research Use Only | Not For Clinical Use.
Online Inquiry