AibGenesis™ Mouse Anti-CHST5 Antibody (CBMOAB-39248FYA)
Cat: CBMOAB-39248FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes) |
| Clone | MO39248FYA |
| Specificity | This antibody binds to Rhesus CHST5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the Gal/GalNAc/GlcNAc 6-O-sulfotransferase (GST) family, members of which catalyze the transfer of sulfate to position 6 of galactose (Gal), N-acetylgalactosamine (GalNAc), or N-acetylglucosamine (GlcNAc) residues within proteoglycans, and sulfation of O-linked sugars of mucin-type acceptors. Carbohydrate sulfation plays a critical role in many biologic processes. This gene is predominantly expressed in colon and small intestine. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus CHST5 Antibody is a mouse antibody against CHST5. It can be used for CHST5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Carbohydrate sulfotransferase 5; CHST5 |
| UniProt ID | H9FKG2 |
| Protein Refseq | The length of the protein is 76 amino acids long. The sequence is show below: VLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWTTLSQGSAATLHMAVRDLMRSVFLCDMDVFDAYMPQSRNLS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry