Mouse Anti-CHTOP Antibody (CBMOAB-39261FYA)


Cat: CBMOAB-39261FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39261FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO39261FYA 100 µg
MO-AB-10235R Monoclonal Cattle (Bos taurus) WB, ELISA MO10235R 100 µg
MO-AB-10984W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10984W 100 µg
MO-AB-24608R Monoclonal Pig (Sus scrofa) WB, ELISA MO24608R 100 µg
MO-AB-24787H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24787C 100 µg
MO-AB-53023W Monoclonal Marmoset WB, ELISA MO53023W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO39261FYA
SpecificityThis antibody binds to Rhesus CHTOP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a small nuclear protein that is characterized by an arginine and glycine rich region. This protein may have an important role in the regulation of fetal globin gene expression and in the activation of estrogen-responsive genes. A recent study reported that this protein binds 5-hydroxymethylcytosine (5hmC) and associates with an arginine methyltransferase complex (methylosome), which promotes methylation of arginine 3 of histone H4 (H4R3) and activation of genes involved in glioblastomagenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus CHTOP Antibody is a mouse antibody against CHTOP. It can be used for CHTOP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCHTOP
UniProt IDF6VBS9
Protein RefseqThe length of the protein is 202 amino acids long.
The sequence is show below: MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND.
For Research Use Only | Not For Clinical Use.
Online Inquiry