AibGenesis™ Mouse Anti-CIDEA Antibody (CBMOAB-39273FYA)


Cat: CBMOAB-39273FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39273FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39273FYA 100 µg
CBMOAB-70550FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70550FYA 100 µg
MO-AB-02410H Monoclonal Frog (Xenopus laevis) WB, ELISA MO02410C 100 µg
MO-AB-10246R Monoclonal Cattle (Bos taurus) WB, ELISA MO10246R 100 µg
MO-AB-24796H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24796C 100 µg
MO-AB-53037W Monoclonal Marmoset WB, ELISA MO53037W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39273FYA
SpecificityThis antibody binds to Rhesus CIDEA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the homolog of the mouse protein Cidea that has been shown to activate apoptosis. This activation of apoptosis is inhibited by the DNA fragmentation factor DFF45 but not by caspase inhibitors. Mice that lack functional Cidea have higher metabolic rates, higher lipolysis in brown adipose tissue and higher core body temperatures when subjected to cold. These mice are also resistant to diet-induced obesity and diabetes. This suggests that in mice this gene product plays a role in thermogenesis and lipolysis. Alternatively spliced transcripts have been identified. (From NCBI)
Product OverviewMouse Anti-Rhesus CIDEA Antibody is a mouse antibody against CIDEA. It can be used for CIDEA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCIDEA
UniProt IDF7HDF4
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: VRGERTSGGPGNRSGSWAREWPGLGPSWKRGLWSPRGAPDRPAEPARPLTFMGSQTKRVLLSPLTHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVITTGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMLGSKHIPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLVYMGTYMLRVLDDKEERPSLRSQVKGRFTCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry