AibGenesis™ Mouse Anti-CILK1 Antibody (MO-AB-10249R)


Cat: MO-AB-10249R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10249R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO10249R 100 µg
MO-AB-21101W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21101W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO10249R
SpecificityThis antibody binds to Cattle CILK1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle CILK1 Antibody is a mouse antibody against CILK1. It can be used for CILK1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesICK protein; ICK
UniProt IDA5PK06
Protein RefseqThe length of the protein is 628 amino acids long.
The sequence is show below: MNRYTTIKQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSRPPYTDYVSTRWYRAPEVLLRSTSYSSPIDIWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSNAMNFRWPQCVPNNLKTLIPNASS.
For Research Use Only | Not For Clinical Use.
Online Inquiry