AibGenesis™ Mouse Anti-CIPK21 Antibody (CBMOAB-22197FYB)


Cat: CBMOAB-22197FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22197FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cottonwood (Populus deltoids) WB, ELISA MO22197FYB 100 µg
CBMOAB-26141FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO26141FC 100 µg
MO-AB-00358H Monoclonal Arabidopsis (Arabidopsis lyrata) WB, ELISA MO00358C 100 µg
MO-AB-27441W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27441W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana), Arabidopsis (Arabidopsis lyrata), Cottonwood (Populus deltoids)
CloneMO22197FYB
SpecificityThis antibody binds to Rice CIPK21.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Rice CIPK21 Antibody is a mouse antibody against CIPK21. It can be used for CIPK21 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCBL-interacting protein kinase 21; EC 2.7.11.1; OsCIPK21; CIPK21; Os07g0637000 LOC_Os07g44290
UniProt IDQ0D4B2
Protein RefseqThe length of the protein is 525 amino acids long.
The sequence is show below: MQKTSMNPVTDPVAAATGRVAIRQLPIKTQPNSQSLTPFLQLPPKPPPNLLFSSPLASVELRHRARARRRRRPSHPRRAPAMRMGKYEMGRALGEGHFGKVKLARHADTGAAFAIKILDRQRILAMKIDEQIKREIATLKLLKHPNVVRLHEVSASKTKIYMVLEYVNGGELFDKIALKGKLSEKEGRKLFQQLMDAVSYCHEKGVYHRDLKPENVLVDAKGNIKVSDFGLSALPQNQRKDGLLHTTCGSPNYIAPEVLLNRGYDGSLSDIWSCGVILYVMLTGNLPFDDQNTVVLYQKILKGDARIPKWLSPGAQDILRKILDPNPITRLDITGIRAHEWFRQDYTPAMPFDDDDDNNISDGNLHMTENQDIETSPAISQINAFQLIGMSSCLDLSGFFEKEDVSERKIRFVSNYSPTSLFEKIESTVTEKGFQVQKNSGKLKVIQVCKEPANPRGHGNLLISAEVFEINESLYVVELKRSSGDCSLYRQLCASLSEDLGICKRQQLLKKDSMRQDLCRYNSSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry