AibGenesis™ Mouse Anti-ckmt1 Antibody (CBMOAB-70619FYA)


Cat: CBMOAB-70619FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70619FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus) WB, ELISA MO70619FYA 100 µg
MO-AB-10270R Monoclonal Cattle (Bos taurus) WB, ELISA MO10270R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus)
CloneMO70619FYA
SpecificityThis antibody binds to Zebrafish ckmt1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ckmt1 Antibody is a mouse antibody against ckmt1. It can be used for ckmt1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCkmt1 protein; Creatine kinase, mitochondrial 1; ckmt1; NP_942096.
UniProt IDQ7ZUN7
Protein RefseqThe length of the protein is 417 amino acids long.
The sequence is show below: MASSFARILSGNRKVGILSLVGAGSLTVGFFLNREQHVSAGSSVRRIYPPSAEYPDLRKHNNCMASHLTPAVYAKLCDKSTPNGYTLDEAIQTGVDNPGHPFIKTVGMVAGDEESYEVFADIFNPVIKERHNGYDPCNMKHPTDLDSSKIRGGMFDEKYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALAGLKGDLTGKYYSLTVMTEQEQQQLIDDHFLFDKPVSPLLTCAGMARDWPDARGIWHNNEKTFLVWINEEDHTRVISMEKGGNMRRVFERFCKGLQEVERLIQEKGWEFMWNERLGYILTCPSNLGTGLRAGVHVNLPRLSKDPRFSKILDNLRLQKRGTGGVDTAAVGSTFDISNLDRLGQSEVQLVQTVIDGVNYLIECERKLEKGQDIKIPAPISQFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry