AibGenesis™ Mouse Anti-CKS1B Antibody (CBMOAB-39314FYA)
Cat: CBMOAB-39314FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-39314FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO39314FYA | 100 µg | ||
| CBMOAB-70627FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO70627FYA | 100 µg | ||
| MO-AB-00217L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00217L | 100 µg | ||
| MO-AB-02427H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO02427C | 100 µg | ||
| MO-AB-06365Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06365Y | 100 µg | ||
| MO-AB-09536W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09536W | 100 µg | ||
| MO-AB-10273R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO10273R | 100 µg | ||
| MO-AB-14581Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14581Y | 100 µg | ||
| MO-AB-23922W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23922W | 100 µg | ||
| MO-AB-24810H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24810C | 100 µg | ||
| MO-AB-32912H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO32912C | 100 µg | ||
| MO-AB-34565W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34565W | 100 µg | ||
| MO-AB-53080W | Monoclonal | Marmoset | WB, ELISA | MO53080W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO39314FYA |
| Specificity | This antibody binds to Rhesus CKS1B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus CKS1B Antibody is a mouse antibody against CKS1B. It can be used for CKS1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cyclin-dependent kinases regulatory subunit; CKS1B |
| UniProt ID | F7HCT1 |
| Protein Refseq | The length of the protein is 79 amino acids long. The sequence is show below: MSHKQIYYLDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIQEPEPHILLFRRPLPKKPKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry