AibGenesis™ Mouse Anti-CLMP Antibody (MO-AB-10349R)


Cat: MO-AB-10349R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-10349R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries) WB, ELISA MO10349R 100 µg
MO-AB-14629Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14629Y 100 µg
MO-AB-24120W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24120W 100 µg
MO-AB-53174W Monoclonal Marmoset WB, ELISA MO53174W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Sheep (Ovis aries)
CloneMO10349R
SpecificityThis antibody binds to Cattle CLMP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte maturation and development of obesity. This gene is also essential for normal intestinal development and mutations in the gene are associated with congenital short bowel syndrome. (From NCBI)
Product OverviewMouse Anti-Cattle CLMP Antibody is a mouse antibody against CLMP. It can be used for CLMP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesASAM protein; ASAM; CLMP
UniProt IDA5D7I8
Protein RefseqThe length of the protein is 373 amino acids long.
The sequence is show below: MTLLVLLGLVSYYVGTLGTHTEIKKVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDREGNQKVVITYSSHHVYNNLTEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSYVILKVLVRPSKPKCELEGELTEGSDLTLQCESSSGTEPIVYSWQRVQEKEGEDERLPPKSKIDYNHPGRVLLQNLTMSSSGLYQCTAGNEAGKESCVVRVTVQYVQSVGMIAGAVTGMVAGALLIFLLVWLL.
For Research Use Only | Not For Clinical Use.
Online Inquiry