AibGenesis™ Mouse Anti-Cni Antibody (CBMOAB-13668FYA)


Cat: CBMOAB-13668FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-13668FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO13668FYA 100 µg
MO-AB-01271Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01271Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO13668FYA
SpecificityThis antibody binds to fruit fly Cni.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Cni Antibody is a mouse antibody against Cni. It can be used for Cni detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein cornichon; cni
UniProt IDP49858
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST.
For Research Use Only | Not For Clinical Use.
Online Inquiry