AibGenesis™ Mouse Anti-cnih2 Antibody (CBMOAB-70918FYA)


Cat: CBMOAB-70918FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70918FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO70918FYA 100 µg
MO-AB-24927H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24927C 100 µg
MO-AB-53248W Monoclonal Marmoset WB, ELISA MO53248W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO70918FYA
SpecificityThis antibody binds to Zebrafish cnih2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cnih2 Antibody is a mouse antibody against cnih2. It can be used for cnih2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein cornichon homolog 2; CNIH-2; Cornichon family AMPA receptor auxiliary protein 2; cnih2; NP_001013542.1;XP_005155427.
UniProt IDQ5BL21
Protein RefseqThe length of the protein is 160 amino acids long.
The sequence is show below: MAFTFAAFCYMLTLVLCAALIFFVIWQIIAFDELRTDFKNPIDQSNPTRARERILNIERICNLLRRLVVPEYSIHGLFCLMFMCAGEWVTLGLNIPLLLYHLWRFFHRPADGSEVMYDPVSVMNADILNYCQKESWCKLGFYLLSFFYYLYSMVYALVSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry