AibGenesis™ Mouse Anti-CNIH3 Antibody (CBMOAB-39499FYA)


Cat: CBMOAB-39499FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39499FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO39499FYA 100 µg
CBMOAB-70919FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO70919FYA 100 µg
MO-AB-11972W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11972W 100 µg
MO-AB-24928H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24928C 100 µg
MO-AB-53249W Monoclonal Marmoset WB, ELISA MO53249W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO39499FYA
SpecificityThis antibody binds to Rhesus CNIH3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CNIH3 Antibody is a mouse antibody against CNIH3. It can be used for CNIH3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCNIH3
UniProt IDF6RG74
Protein RefseqThe length of the protein is 185 amino acids long.
The sequence is show below: MAFTFAAFCYMLSLVLCAALIFFAIWHIIAFDELRTDFKSPIDQCNPVHARERLRNIERICFLLRKLVLPEYSIHSLFCIMFLCAQEWLTLGLNVPLLFYHFWRYFHCPADSSELAYDPPVVMNADTLSYCQKEAWCKLAFYLLSFFYYLYCMIYTFSELLTQRPCTSSETEMGETSDGEVHFCW.
For Research Use Only | Not For Clinical Use.
Online Inquiry