AibGenesis™ Mouse Anti-cnot8 Antibody (CBMOAB-70975FYA)


Cat: CBMOAB-70975FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-70975FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset WB, ELISA MO70975FYA 100 µg
MO-AB-21233W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21233W 100 µg
MO-AB-53281W Monoclonal Marmoset WB, ELISA MO53281W 100 µg
MO-DKB-01071W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Rhesus (Macaca mulatta), Frog (Xenopus) WB, IF 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Primat, Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset
CloneMO70975FYA
SpecificityThis antibody binds to Zebrafish cnot8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish cnot8 Antibody is a mouse antibody against cnot8. It can be used for cnot8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCCR4-NOT transcription complex, subunit 8; cnot
UniProt IDQ7SXS5
Protein RefseqThe length of the protein is 285 amino acids long.
The sequence is show below: MPAALADTSQIICEVWASNVEEEMRKIRQIIQNYNYIAMDTEFPGVVVRPIGEFRSTVDYQYQLLRCNVDLLKIVQLGLTFMNEDGDYPPGTTTWQFNFKFNLTEDMYSQDSIDLLQNSGLQFKKHEEEGIDTLYFAELLMTSGLVLCENVKWLSFHSGYDFGYLVKLLTDSRLPEEEHEFFQILNLFFPAIYDVKYLMKSCKNLKGGLQEVADQLELKRIGRQHQAGSDSLLTGMAFFRMKELFFEDNIDDAKYCGRLYGLGSGSTQSQNGISNSSQEETNNKH.
For Research Use Only | Not For Clinical Use.
Online Inquiry