AibGenesis™ Mouse Anti-COPRS Antibody (CBMOAB-39719FYA)


Cat: CBMOAB-39719FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-39719FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO39719FYA 100 µg
MO-AB-10565R Monoclonal Cattle (Bos taurus) WB, ELISA MO10565R 100 µg
MO-AB-15013W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15013W 100 µg
MO-AB-24982H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24982C 100 µg
MO-AB-53398W Monoclonal Marmoset WB, ELISA MO53398W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO39719FYA
SpecificityThis antibody binds to Rhesus COPRS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus COPRS Antibody is a mouse antibody against COPRS. It can be used for COPRS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOPRS
UniProt IDF6U7Z3
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MDPQAARAQARRAAEPSRGPPLPSAQEAPPSPEAGFATADHSSQERETEKAMDRLGKDTQSVPNDSPAQGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDIFNEDWDLELKADQGNPYDADDIQESISQELKPWVCCAPQGDMIYDPSWHHPPPLIPHYSKMVFETGQFDDAED.
For Research Use Only | Not For Clinical Use.
Online Inquiry