AibGenesis™ Mouse Anti-COPT4 Antibody (CBMOAB-22301FYB)


Cat: CBMOAB-22301FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22301FYB Monoclonal Rice (Oryza), A. thaliana (Arabidopsis thaliana) WB, ELISA MO22301FYB 100 µg
CBMOAB-26423FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO26423FC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), A. thaliana (Arabidopsis thaliana)
CloneMO22301FYB
SpecificityThis antibody binds to Rice COPT4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice COPT4 Antibody is a mouse antibody against COPT4. It can be used for COPT4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCOPT4
UniProt IDF5BCS1
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MRGMGDDGMGPMAMAPPRSGHATAAAPPPPQHKMAMMMHMTFFWSDRAVVLIRGWPGERGAGMYALCLLFVLALAALTEGLSVLSRRLARRGGGAASSDGGRPAPAPASSAALLTAVHAARMGMAYLVMLAVMSFNVGVLLAAVAGHALGFLLARSRVRPAARDGGGGVACEHGGLPPADGSKT.
For Research Use Only | Not For Clinical Use.
Online Inquiry