Mouse Anti-Cottonwood COQ5 Antibody (MO-AB-27495W)


Cat: MO-AB-27495W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCottonwood (Populus deltoids)
CloneMO27495W
SpecificityThis antibody binds to Cottonwood COQ5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCOQ5 (Coenzyme Q5, Methyltransferase) is a Protein Coding gene. Among its related pathways are Ubiquinol biosynthesis and Metabolism. Gene Ontology (GO) annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity.
Product OverviewMouse Anti-Cottonwood COQ5 Antibody is a mouse antibody against COQ5. It can be used for COQ5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiE / COQ5 methyltransferase family protein
UniProt IDB9ILV4
Protein RefseqThe length of the protein is 289 amino acids long.
The sequence is show below: MALKLVSRKLGSKFLPMLSSTSPLHSHATSFGFKHVREEEKSQMVGNVFSSVASNYDLMNDLMSGGLHRLWKDRLVSMLNPFPGMKHLDVAGGTGDVAFKILDGISSIKRRANQDPINDHLQEETQIHVCDINPNMLNVGKKRAIERGLGEDKSLIWVEGDAEALSFEDNTMDGYTIAFGIRNVTHIEKVLAEAYRVLKHGGRFLCLELSHVEVPVFKELYDYYSFSVIPAVGELVAGDRDSYQYLVESIRRFPPQVKFASMIADAGFQKVEYENLVGGVVAIHSGLKI.
See other products for " COQ5 "
CBMOAB-39737FYAMouse Anti-Rhesus COQ5 Antibody (CBMOAB-39737FYA)
MO-AB-34613WMouse Anti-Ferret COQ5 Antibody (MO-AB-34613W)
MO-AB-47824WMouse Anti-Maize COQ5 Antibody (MO-AB-47824W)
CBMOAB-02095HCBMouse Anti-C. elegans COQ5 Antibody (CBMOAB-02095HCB)
MO-AB-03553WMouse Anti-Rhesus COQ5 Antibody (MO-AB-03553W)
MO-AB-10888WMouse Anti-Chimpanzee COQ5 Antibody (MO-AB-10888W)
MO-AB-02391WMouse Anti-Fruit fly Coq5 Antibody (MO-AB-02391W)
MO-AB-01352YMouse Anti-Chicken COQ5 Antibody (MO-AB-01352Y)
CBMOAB-22310FYBMouse Anti-Rice COQ5 Antibody (CBMOAB-22310FYB)
MO-AB-01000HMouse Anti-Arabidopsis COQ5 Antibody (MO-AB-01000H)
For Research Use Only | Not For Clinical Use.
Online Inquiry