AibGenesis™ Mouse Anti-CTXN1 Antibody (MO-AB-23289W)


Cat: MO-AB-23289W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-23289W Monoclonal Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus) WB, ELISA MO23289W 100 µg
MO-AB-25196H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25196C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Rat (Rattus norvegicus)
CloneMO23289W
SpecificityThis antibody binds to Chimpanzee CTXN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Chimpanzee CTXN1 Antibody is a mouse antibody against CTXN1. It can be used for CTXN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCortexin 1; CTXN1
UniProt IDH2R6E3
Protein RefseqThe length of the protein is 82 amino acids long.
The sequence is show below: MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRMPASSWTDHKEALERGQFDYALV.
For Research Use Only | Not For Clinical Use.
Online Inquiry