AibGenesis™ Mouse Anti-ctxn2 Antibody (CBMOAB-72264FYA)
Cat: CBMOAB-72264FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-72264FYA | Monoclonal | Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO72264FYA | 100 µg | ||
| MO-AB-25197H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25197C | 100 µg | ||
| MO-AB-53734W | Monoclonal | Marmoset | WB, ELISA | MO53734W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO72264FYA |
| Specificity | This antibody binds to Zebrafish ctxn2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish ctxn2 Antibody is a mouse antibody against ctxn2. It can be used for ctxn2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cortexin-2; ctxn2; NP_001189362.1;XP_005173676. |
| UniProt ID | Q592E4 |
| Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: MCSVHYNHSLAAMSGSDIMAYSLSLEQKTAFAFVGMLLVFLGLLIVRCFRILLDPYSSMPSSSWGDGLEGLEKGTFEYALT. |
For Research Use Only | Not For Clinical Use.
Online Inquiry