AibGenesis™ Mouse Anti-ctxn2 Antibody (CBMOAB-72264FYA)


Cat: CBMOAB-72264FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-72264FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO72264FYA 100 µg
MO-AB-25197H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25197C 100 µg
MO-AB-53734W Monoclonal Marmoset WB, ELISA MO53734W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO72264FYA
SpecificityThis antibody binds to Zebrafish ctxn2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ctxn2 Antibody is a mouse antibody against ctxn2. It can be used for ctxn2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCortexin-2; ctxn2; NP_001189362.1;XP_005173676.
UniProt IDQ592E4
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: MCSVHYNHSLAAMSGSDIMAYSLSLEQKTAFAFVGMLLVFLGLLIVRCFRILLDPYSSMPSSSWGDGLEGLEKGTFEYALT.
For Research Use Only | Not For Clinical Use.
Online Inquiry