AibGenesis™ Mouse Anti-Cx26 Antibody (MO-AB-25202H)


Cat: MO-AB-25202H

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25202H Monoclonal Rat (Rattus norvegicus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Hamsters (Cricetinae) WB, ELISA MO25202C 100 µg
MO-AB-29956W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29956W 100 µg
MO-AB-41492W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41492W 100 µg
MO-AB-43043W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43043W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcellus), Hamsters (Cricetinae)
CloneMO25202C
SpecificityThis antibody binds to Rat Cx26.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionOne gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against Cx26. It can be used for Cx26 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGap junction protein; Gjb2; Cx26
UniProt IDQ80XF9
Protein RefseqThe length of the protein is 177 amino acids long.
The sequence is show below: GKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIMVSTPALLVAMHVAYRRHEKKRKFMKGEIKNEFKDIEEIKTQKVRIEGSLWWTYTTSIFFRVIFEAVFMYVFYIMYNGFFMQRLVKCNAWPCPNTVDCFISRPTEKTVFTVFMIS.
For Research Use Only | Not For Clinical Use.
Online Inquiry