Mouse Anti-CYBB Antibody (MO-AB-14791Y)
Cat: MO-AB-14791Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-14791Y | Monoclonal | Sheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) | WB, ELISA | MO14791Y | 100 µg | ||
CBMOAB-0468YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0468YC | 100 µg | ||
CBMOAB-72540FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72540FYA | 100 µg | ||
MO-AB-11007R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11007R | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) |
Clone | MO14791Y |
Specificity | This antibody binds to Sheep CYBB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | This product is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytochrome b-245 beta polypeptide; CYBB |
UniProt ID | Q30DU3 |
Protein Refseq | The length of the protein is 64 amino acids long. The sequence is show below: LQEKNNTGFLSYNIYLTGWDESQASHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHP. |
See other products for " CYBB "
MO-AB-29982W | Mouse Anti-CYBB Antibody (MO-AB-29982W) |
CBMOAB-40204FYA | Mouse Anti-CYBB Antibody (CBMOAB-40204FYA) |
MO-AB-07767Y | Mouse Anti-CYBB Antibody (MO-AB-07767Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry