Mouse Anti-CYBB Antibody (MO-AB-14791Y)


Cat: MO-AB-14791Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14791Y Monoclonal Sheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) WB, ELISA MO14791Y 100 µg
CBMOAB-0468YC Monoclonal E. coli (Escherichia coli ) WB, ELISA MO0468YC 100 µg
CBMOAB-72540FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72540FYA 100 µg
MO-AB-11007R Monoclonal Cattle (Bos taurus) WB, ELISA MO11007R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio)
CloneMO14791Y
SpecificityThis antibody binds to Sheep CYBB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b-245 beta polypeptide; CYBB
UniProt IDQ30DU3
Protein RefseqThe length of the protein is 64 amino acids long. The sequence is show below: LQEKNNTGFLSYNIYLTGWDESQASHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHP.
For Research Use Only | Not For Clinical Use.
Online Inquiry