Mouse Anti-CYBB Antibody (MO-AB-14791Y)
Cat: MO-AB-14791Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-14791Y | Monoclonal | Sheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) | WB, ELISA | MO14791Y | 100 µg | ||
| CBMOAB-0468YC | Monoclonal | E. coli (Escherichia coli ) | WB, ELISA | MO0468YC | 100 µg | ||
| CBMOAB-72540FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO72540FYA | 100 µg | ||
| MO-AB-11007R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO11007R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries), Cattle (Bos taurus), E. coli (Escherichia coli ), Zebrafish (Danio rerio) |
| Clone | MO14791Y |
| Specificity | This antibody binds to Sheep CYBB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CYBB (Cytochrome B-245 Beta Chain) is a Protein Coding gene. Diseases associated with CYBB include Immunodeficiency 34 and Granulomatous Disease, Chronic, X-Linked. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and heme binding. An important paralog of this gene is NOX1. |
| Product Overview | This product is a mouse antibody against CYBB. It can be used for CYBB detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytochrome b-245 beta polypeptide; CYBB |
| UniProt ID | Q30DU3 |
| Protein Refseq | The length of the protein is 64 amino acids long. The sequence is show below: LQEKNNTGFLSYNIYLTGWDESQASHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIGSQHP. |
See other products for " CYBB "
| CBMOAB-40204FYA | Mouse Anti-CYBB Antibody (CBMOAB-40204FYA) |
| MO-AB-29982W | Mouse Anti-CYBB Antibody (MO-AB-29982W) |
| MO-AB-07767Y | Mouse Anti-CYBB Antibody (MO-AB-07767Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry