AibGenesis™ Mouse Anti-CYCD3;3 Antibody (MO-AB-27509W)


Cat: MO-AB-27509W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-27509W Monoclonal Cottonwood (Populus deltoids), Tomato (Lycopersicon esculentum) WB, ELISA MO27509W 100 µg
MO-AB-34348H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34348C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCottonwood (Populus deltoids), Tomato (Lycopersicon esculentum)
CloneMO27509W
SpecificityThis antibody binds to Cottonwood CYCD3;3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cottonwood CYCD3;3 Antibody is a mouse antibody against CYCD3;3. It can be used for CYCD3;3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesD3-type cyclin; CYCD33
UniProt IDA8Y911
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: ELNSQQEQNASFLLDALYCEEGRWEDESEEEVLQESTFVNDLFPLSLLEQDLFWEDEELLSLFSKEQEQQASVSVNNVADDPFLSRARQEAVEWMLKVIAHYGFSALTSILAFNYLDRFLSGPCYQRDSRPWMIQLVAVTCLSLAAKVEETHVPFLLDLQVEDTKYVFEAKTIQRMELLVLSTLKWKMHPVTPLSFLDHIIRRLGLKTHVHWEFLRRCEHLLLSVVSDSRSVSYLPSVLATATMMHVIDQVETFNPIDYQNQLLDVLKITKEKVNGCYGLILELSRNRTIANNKSQKRKFEPMPSSPSGVIGAVFSSDSSNDSWAVQGSSVSSSPEPLFKKSRTQDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry