AibGenesis™ Mouse Anti-CYP51 Antibody (CBMOAB-22428FYB)


Cat: CBMOAB-22428FYB

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-22428FYB Monoclonal Rice (Oryza), Chicken (Gallus gallus), Pig (Sus scrofa), Purple sea urchin (Strongylocentrotus purpuratus), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio) WB, ELISA MO22428FYB 100 µg
CBMOAB-72784FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO72784FYA 100 µg
MO-AB-01503Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01503Y 100 µg
MO-AB-25073R Monoclonal Pig (Sus scrofa) WB, ELISA MO25073R 100 µg
MO-AB-30627H Monoclonal Purple sea urchin (Strongylocentrotus purpuratus) WB, ELISA MO30627C 100 µg
MO-AB-34351H Monoclonal Tomato (Lycopersicon esculentum) WB, ELISA MO34351C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Chicken (Gallus gallus), Pig (Sus scrofa), Purple sea urchin (Strongylocentrotus purpuratus), Tomato (Lycopersicon esculentum), Zebrafish (Danio rerio)
CloneMO22428FYB
SpecificityThis antibody binds to Rice CYP51.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice CYP51 Antibody is a mouse antibody against CYP51. It can be used for CYP51 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterol 14-demethylase; CYP51
UniProt IDQ9SXU9
Protein RefseqThe length of the protein is 427 amino acids long.
The sequence is show below: REEYARLGSVFTVPILSRKITFLIGPEVSAHFFKGNEAEMSQQEVYKFNVPTFGPGVVFDVDYSVRQEQFRFFTEALRANKLRSYVDQMVVEAEEYFSKWGESGTVDLKYELEHLIILTASRCLLGREVREKLFDDVSSLFHDLDNGMQPVSVIFPYLPIPAHRRRDRARQRLKEIFATIIKSRKASGRAEEDMLQCFIDSKYKSGRSTTEGEITGLLIAALFAGQHTSSITSTWTGAYMLRFKQYFAAAEEEQKEVMKRHGDKIDHDILAEMDVLYRCIKEALRLHPPLIMLLRQSHNDFSVTTKDGKEFDIPKGHIVATSPAFANRLPHIFKNPDSYDPDPYAPGREEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHLLRNFEFELVSPFPETNWKAMVVGIKDEVMVNFKRRKLVVDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry