AibGenesis™ Mouse Anti-Cys Antibody (CBMOAB-14502FYA)


Cat: CBMOAB-14502FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-14502FYA Monoclonal Fruit fly (Drosophila melanogaster), Soybean (Glycine max) WB, ELISA MO14502FYA 100 µg
MO-AB-31338H Monoclonal Soybean (Glycine max) WB, ELISA MO31338C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Soybean (Glycine max)
CloneMO14502FYA
SpecificityThis antibody binds to fruit fly Cys.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Cys Antibody is a mouse antibody against Cys. It can be used for Cys detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCystatin-like protein; Cys
UniProt IDP23779
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MNVVKSLCILGLVLVSLIATQAADEQVVGGVSQLEGNSRKEALELLDATLAQLATGDGPSYKAINVTSVTGQVVAGSLNTYEVELDNGSDKKQCTVKIWTQPWLKENGTNIKIKCSGDDGELDRTW.
For Research Use Only | Not For Clinical Use.
Online Inquiry