Mouse Anti-CYTIP Antibody (CBMOAB-40338FYA)
Cat: CBMOAB-40338FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus) |
| Clone | MO40338FYA |
| Specificity | This antibody binds to Rhesus CYTIP. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | CYTIP (Cytohesin 1 Interacting Protein) is a Protein Coding gene. Among its related pathways are Amplification and Expansion of Oncogenic Pathways as Metastatic Traits. An important paralog of this gene is GRASP. |
| Product Overview | Mouse Anti-Rhesus CYTIP Antibody is a mouse antibody against CYTIP. It can be used for CYTIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytohesin-interacting protein; CYTIP |
| UniProt ID | H9F3T6 |
| Protein Refseq | The length of the protein is 75 amino acids long. The sequence is show below: FIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNFSSAFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF. |
See other products for " CYTIP "
| MO-AB-03586W | Mouse Anti-CYTIP Antibody (MO-AB-03586W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry