AibGenesis™ Mouse Anti-CYTIP Antibody (MO-AB-03586W)


Cat: MO-AB-03586W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03586W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO03586W 100 µg
MO-AB-11150R Monoclonal Cattle (Bos taurus) WB, ELISA MO11150R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO03586W
SpecificityThis antibody binds to Rhesus CYTIP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CYTIP Antibody is a mouse antibody against CYTIP. It can be used for CYTIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytohesin 1 Interacting Protein; Cytohesin Binder And Regulator; Pleckstrin Homology Sec7 And Coiled-Coil Domains-Binding Protein; Cytohesin-Associated Scaffolding Protein; Cytohesin Binding Protein HE; Cbp HE; PSCDBP; CASP
UniProt IDF7AT53
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MSLQRLLQHSSNGNLADFSAGPAYSSYSTLTGSLTMDDNRRIQMLADTVATLPRGRKQEISLQSSKTITKFSWVTNEPVRIQDRHTRGCSEMKSYRPQNQNACSSEMFTLICKIQEDSPAHCAGLQAGDVLANINGVSTEGFTHKQVVDLIRSSGNLLTIETLNGTMILKRTELEAKLQVLKQTLKQKWVEYRSLQLQEHRLLHGDAANCPSLENMDLDELSLFGPLPGPGPALVDRNRLSSESSCKSWLSSMTMDSEDGYQTCVSEDSSRGAFSRQTSTDDECFIPKEGDDFLRRSSSRRNRSISNTSSGSMSPLWEGNFSSAFGTLPRKSRKGSVRKQLLKFIPGLHRAVEEEESRF.
See other products for " CYTIP "
For Research Use Only | Not For Clinical Use.
Online Inquiry