Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-D. melanogaster 4Ehp Antibody (CBMOAB-00330FYA)


Cat: CBMOAB-00330FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00330FYA
SpecificityThis antibody binds to fruit fly 4Ehp.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction4EHP, EIF4E-Homologous Protein (4EHP) binds the 7-methyl-guanosine cap structure of mRNA and functions as a negative regulator of translation.
Product OverviewMouse Anti-D. melanogaster 4Ehp (clone MO00330FYA) Antibody (CBMOAB-00330FYA) is a mouse antibody against 4Ehp. It can be used for 4Ehp detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names4EHP, isoform B; 4EHP
UniProt IDE1JIV5
Protein RefseqThe length of the protein is 248 amino acids long.
The sequence is show below: MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPSIQVACSSRPIICIIYTRFVVQFGKCKIIIVTNNNKRNVYEFLTIIVIKIHEEMLSLLSRKCKFVNAPNELVTRIGRFLF.

See other products for " 4Ehp "

For Research Use Only | Not For Clinical Use.

Online Inquiry