Mouse Anti-D. melanogaster Ada Antibody (CBMOAB-00674FYA)


Cat: CBMOAB-00674FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO00674FYA
SpecificityThis antibody binds to fruit fly Ada.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
Product OverviewMouse Anti-D. melanogaster Ada Antibody is a mouse antibody against Ada. It can be used for Ada detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine deaminase-like protein; EC 3.5.4.-; Ada
UniProt IDQ9VHH7
Protein RefseqThe length of the protein is 337 amino acids long.
The sequence is show below: MEQFLKGLPKVELHAHLNGSLGIKSLCDLGERLYGTSCKDFLKLCAHFSRFEKDMDACFEKFAFVHELTSTREGLRFATELAIRDFAEDNVQYVEMRTTPKANENYSRRDYLQIVIDAIKAASETYPEITVKLLPSINRAEPVDVAEETVSLAVELARAHPNLILGIDLSGNPGKGRFSDFAPILAQARDKGLKLAIHCAEIENPSEVKEMLHFGMSRCGHGTFLTPEDIGQLKQRNIAIECCLTSNVKSGTVPSLEEHHLKRIMEADAPKVICTDDSGVFDTTLTKEFLIAAETFGLTREQCIDLTLEAVHHSFASEQEQIQMADRVGNYADILVK.
For Research Use Only | Not For Clinical Use.
Online Inquiry