AibGenesis™ Mouse Anti-D. melanogaster Betatub56D Antibody (CBMOAB-02407FYA)


Cat: CBMOAB-02407FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02407FYA
SpecificityThis antibody binds to fruit fly Betatub56D.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTubulin is the major constituent of microtubules, a cylinder consisting of laterally associated linear protofilaments composed of alpha- and beta-tubulin heterodimers. Microtubules grow by the addition of GTP-tubulin dimers to the microtubule end, where a stabilizing cap forms. Below the cap, tubulin dimers are in GDP-bound state, owing to GTPase activity of alpha-tubulin. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Betatub56D Antibody is a mouse antibody against Betatub56D. It can be used for Betatub56D detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBeta-Tubulin at 56D, isoform A; FI19422p1; betaTub56D; betaTub56D-RA
UniProt IDA1ZBL0
Protein RefseqThe length of the protein is 456 amino acids long.
The sequence is show below: MLIGARPIHRVYDGVHGWPKPRSRAQTCFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYVPRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATADEDAEFEEEQEAEVDEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry