AibGenesis™ Mouse Anti-D. melanogaster Bol Antibody (CBMOAB-02598FYA)


Cat: CBMOAB-02598FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02598FYA
SpecificityThis antibody binds to fruit fly Bol.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRNA-binding protein that plays a central role in spermatogenesis. Required for meiotic entry and germline differentiation, at the transition between G2 and M phases of meiosis I. Acts by regulating translation of specific mRNAs, possibly by binding to their 3''-UTR. Essential for translation of twine (twe) mRNA. Required for the expression of various genes such as CG6784, CG17210, CG15841 scpr-B, scpr-C, and rho-6. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Bol Antibody is a mouse antibody against Bol. It can be used for Bol detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBoule, isoform D; Boule, isoform G; bol
UniProt IDA4V1Q0
Protein RefseqThe length of the protein is 228 amino acids long.
The sequence is show below: MHKIAAAPPPSATPGGGLETPLAAPKYGTLIPNRIFVGGISGDTTEADLTRVFSAYGTVKSTKIIVDRAGVSKGYGFVTFETEQEAQRLQADGECVVLRDRKLNIAPAIKKQPNPLQSIVATNGAVYYTTTPPAPISNIPMDQFAAAVYPPAAGVPAIYPPSAMQYQPFYQYYSVPMNVPTIWPQNYQENHSPLLHSPTSNPHSPHSQSHPQSPCWSIEDLRDTLPRV.
For Research Use Only | Not For Clinical Use.
Online Inquiry