AibGenesis™ Mouse Anti-D. melanogaster Bun Antibody (CBMOAB-02793FYA)


Cat: CBMOAB-02793FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02793FYA
SpecificityThis antibody binds to fruit fly Bun.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor required for peripheral nervous system morphogenesis, eye development and oogenesis. May be required for the transmission of the dpp signal and for a morphogenetic movement of the medulla in the brain that reorients the second optic lobe relative to the first. Plays a role in determining proper dorsal cell fates leading to the formation of the dorsal appendages. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Bun Antibody is a mouse antibody against Bun. It can be used for Bun detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBunched, isoform O; bun
UniProt IDM9PCT7
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MENKNNLEIAFNNGNIFIKSASGTSAVAIDNKIEQAMDLVKSHLMIAVREEVEVLKERISELMDKINKLELENSILKSNIPQETLQQLQLQLQLAAPPATPAIQAAPAVQSVVAPAAAGQAVQQQAAGAVAVTGVATSPASAVVPTSIPNGSAENGSSAVESAAVSVEQQVQQVTSAAAAAASVVTANGPMS.
For Research Use Only | Not For Clinical Use.
Online Inquiry