AibGenesis™ Mouse Anti-D. melanogaster Gr68A Antibody (CBMOAB-18081FYA)


Cat: CBMOAB-18081FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO18081FYA
SpecificityThis antibody binds to fruit fly Gr68A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDsx-dependent essential component of pheromone-driven courtship behavior (PubMed:12971900). Recognizes a female pheromone involved in the second step (tapping step) of the courtship display which is essential for efficient execution of the entire courtship sequence and timely mating (PubMed:12971900). Required for detection of the male sex pheromone CH503 which is transferred from males to females during mating and inhibits courtship behavior by other males (PubMed:26083710). Gr68a-expressing neurons in the male foreleg relay signals to the suboesophageal zone (SEZ) and courtship suppression is mediated by the release of the neuropeptide tachykinin from a cluster of 8-10 neurons in the SEZ (PubMed:26083710). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Gr68A Antibody is a mouse antibody against Gr68A. It can be used for Gr68A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGustatory receptor 68a; Gr68a; GR68D.1
UniProt IDQ9VTN0
Protein RefseqThe length of the protein is 389 amino acids long.
The sequence is show below: MKIYQDIYPISKPSQIFAILPFYSGDVDDGFRFGGLGRWYGRLVALIILIGSLTLGEDVLFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDEYLLANGFRETYSCRNLTILVTSAAGGVLAVAFYYIHYRSGIGAKRQIILLLIYFLQLLYSTLLALYLRTLMMNLAQRIGFLNQKLDTFNLQDCGHMENWRELSNLIEVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSLSSKTEVADTIGLSCIWVLAETITMIVICSACDGLASEVNGTAQILARIYGKSKQFQNLIDKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDISQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry