Mouse Anti-D. melanogaster His1 Antibody (CBMOAB-20532FYA)


Cat: CBMOAB-20532FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO20532FYA
SpecificityThis antibody binds to fruit fly His1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe nucleosome is the smallest subunit of chromatin and consists of 147 DNA base pairs wrapped around the core histone octamer (histone H2A, histone H2B, histone H3, and histone H4). Histone H1 is a linking histone protein that exists at the interface between the nucleosome core and the DNA entry/exit point. Histone H1 is responsible for building higher-order chromatin structures. Chromatin undergoes a variety of chemical modifications, including post-translational modifications of histones and methylation of cytosine residues in DNA. The reported histone modifications include acetylation, methylation, phosphorylation, ubiquitination, glycosylation, ADP-ribosylation, carbonylation and SUMOylation, and play a major role in regulating gene expression.
Product OverviewMouse Anti-D. melanogaster His1 Antibody is a mouse antibody against His1. It can be used for His1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD45862p; Fragment; His1
UniProt IDQ5BI49
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: LSEKKMSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSASAKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAENKKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVIAKASKAKPAVSAKPKKTVKKASVSATAKKPKAKTTAAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry