Mouse Anti-D. melanogaster Msr1 Antibody (CBMOAB-24889FYA)


Cat: CBMOAB-24889FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO24889FYA
SpecificityThis antibody binds to fruit fly Msr1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages.
Product OverviewMouse Anti-D. melanogaster Msr1 Antibody is a mouse antibody against Msr1. It can be used for Msr1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyosuppressin receptor 1, isoform B; MsR1
UniProt IDM9PEC0
Protein RefseqThe length of the protein is 556 amino acids long.
The sequence is show below: MASGNNETEPLYCGSGMDNFHTSYKNMHGYVSLVVCILGTIANTLNIIVLTRREMRSPTNAILTGLAVADLAVMLEYIPYTIHDYILTDSLPREEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKNRVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELLSARTAALNATPTSAPLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQNATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLTSKPATPGASNGTKSPANGKAADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMDILALINSSINFILYCSMSKQFRTTFTLLFRPKFLDKWLPVAQDEMAAARAERSAVAPVLEKGRQQPQVVMASTTTNITQVTNLXHRRSRGRRTLLSRLLSVLKRGRRRSSGEGGGVGGGGAPLAGNDAVEPAFQAIVVVVDKVSGATENQLYTAEQARIVT.
For Research Use Only | Not For Clinical Use.
Online Inquiry