Mouse Anti-D. melanogaster Ogg1 Antibody (CBMOAB-26436FYA)


Cat: CBMOAB-26436FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO26436FYA
SpecificityThis antibody binds to fruit fly Ogg1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.
Product OverviewMouse Anti-D. melanogaster Ogg1 Antibody is a mouse antibody against Ogg1. It can be used for Ogg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRE57519p; Ogg1
UniProt IDQ6NL83
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MLAHNLGFHKKRLFSNMKAVLQDRGVIGLSLEECDLERTLLGGQSFRWRSICDGNRTKYGGVVFNTYWVLQQEESFITYEAYGTSSPLATKDYSSLISDYLRVDFDLKVNQKDWLSKDDNFVKFLSKPVRLLSQEPFENIFSFLCSQNNNIKRISSMIEWFCATFGTKIGHFNGADAYTFPTINRFHDIPCEDLNAQLRAAKFGYRAKFIAQTLQEIQKKGGQNWFISLKSMPFEKAREELTLLPGIGYKVADCICLMSMGHLESVPVDIHIYRIAQNYYLPHLTGQKNVTKKIYEEVSKHFQKLHGKYAGWAQAILFSADLSQFQNTSTVACKKNPIKNLKSDLIYWIKKKNIPTCNI.
For Research Use Only | Not For Clinical Use.
Online Inquiry