Mouse Anti-Rat Ogg1 Antibody (MO-AB-27656H)


Cat: MO-AB-27656H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27656C
SpecificityThis antibody binds to Rat Ogg1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the enzyme responsible for the excision of 8-oxoguanine, a mutagenic base byproduct which occurs as a result of exposure to reactive oxygen. The action of this enzyme includes lyase activity for chain cleavage. Alternative splicing of the C-terminal region of this gene classifies splice variants into two major groups, type 1 and type 2, depending on the last exon of the sequence. Type 1 alternative splice variants end with exon 7 and type 2 end with exon 8. All variants share the N-terminal region in common, which contains a mitochondrial targeting signal that is essential for mitochondrial localization. Many alternative splice variants for this gene have been described, but the full-length nature for every variant has not been determined.
Product OverviewThis product is a mouse antibody against Ogg1. It can be used for Ogg1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOgg1 protein; Ogg1
UniProt IDB2RYK1
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MLFSSSLSSSMRHRTLTSSPALWASIPCPRSELRLDLVLASGQSFRWREQSPAHWSGVLADQVWTLTQTEDQLYCTVYRGDKGQVGRPTLEELETLHKYFQLDVSLTQLYSHWASVDSHFQSVAQKFQGLWTSTRSA.
See other products for " OGG1 "
CBMOAB-02723CRMouse Anti-Yeast OGG1 Antibody (CBMOAB-02723CR)
MO-AB-17137RMouse Anti-Cattle OGG1 Antibody (MO-AB-17137R)
CBMOAB-53345FYAMouse Anti-Rhesus OGG1 Antibody (CBMOAB-53345FYA)
CBMOAB-37801FYCMouse Anti-Arabidopsis OGG1 Antibody (CBMOAB-37801FYC)
CBMOAB-26436FYAMouse Anti-D. melanogaster Ogg1 Antibody (CBMOAB-26436FYA)
CBMOAB-90515FYAMouse Anti-Zebrafish ogg1 Antibody (CBMOAB-90515FYA)
MO-AB-21288WMouse Anti-Chimpanzee OGG1 Antibody (MO-AB-21288W)
MO-AB-00762HMouse Anti-Arabidopsis OGG1 Antibody (MO-AB-00762H)
For Research Use Only | Not For Clinical Use.
Online Inquiry