AibGenesis™ Mouse Anti-D. melanogaster Pgant6 Antibody (CBMOAB-27519FYA)


Cat: CBMOAB-27519FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO27519FYA
SpecificityThis antibody binds to fruit fly Pgant6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGlycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide (PubMed:12829714). In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties (PubMed:12829714). Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified (PubMed:12829714). Prefers the diglycosylated Muc5AC-3/13 as substrate (PubMed:12829714). Might have a role in protein O-glycosylation in the Golgi and thereby in establishing and/or maintaining a proper secretory apparatus structure (PubMed:20807760). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Pgant6 Antibody is a mouse antibody against Pgant6. It can be used for Pgant6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesN-acetylgalactosaminyltransferase 6; EC 2.4.1.-; Protein-UDP acetylgalactosaminyltransferase 6; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 6; pp-GaNTase 6; pgant6
UniProt IDQ6WV16
Protein RefseqThe length of the protein is 666 amino acids long.
The sequence is show below: MRRPNLKWIVKASLLLLISLTLFVLITSWISSTPYTNKPVHHGVEPVPEKAGLSGDVKVKVPAIKQPEPQKPQEPDFEEDPELQKIDEPEPVEEEVDNPHPADDEPQQQPQEELQMAAPADASVKKDWHDYTFMEKDAKRVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVAKLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAEHFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTAVCPFIDVIDHTNFHYRAQDEGARGAFDWEFFYKRLPLLPEDLKHPADPFKSPIMAGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRGPRNHQPSPRKGDYLHKNYKRVAEVWMDEYKNYLYSHGDGLYESVDPGDLTEQKAIRTKLNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYACADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYRHKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFNKTALDNYSQDLVLSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry