AibGenesis™ Mouse Anti-D. melanogaster Snf Antibody (CBMOAB-31396FYA)


Cat: CBMOAB-31396FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO31396FYA
SpecificityThis antibody binds to fruit fly Snf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBinds stem loop II of U1 snRNA. It is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. Plays a role in regulating sex-lethal splicing. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Snf Antibody is a mouse antibody against Snf. It can be used for Snf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesU1 small nuclear ribonucleoprotein A; U1 snRNP A; U1-A; U1A; Sex determination protein snf; snf; D25 fs(1)1621 liz
UniProt IDP43332
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKKVKPPKPAPGTDEKKDKKKKPSSAENSNPNAQTEQPPNQILFLTNLPEETNEMMLSMLFNQFPGFKEVRLVPNRHDIAFVEFTTELQSNAAKEALQGFKITPTHAMKITFAKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry