AibGenesis™ Mouse Anti-D. melanogaster Spz Antibody (CBMOAB-31821FYA)


Cat: CBMOAB-31821FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO31821FYA
SpecificityThis antibody binds to fruit fly Spz.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe activated form, spaetzle C-106, acts as a ligand for the Toll receptor (PubMed:12872120). Binding to Toll activates the Toll signaling pathway and induces expression of the antifungal peptide drosomycin (PubMed:8808632). Component of the extracellular signaling pathway that establishes dorsal-ventral polarity in the embryo (PubMed:8124709, PubMed:11212919). (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Spz Antibody is a mouse antibody against Spz. It can be used for Spz detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein spaetzle; [Cleaved into: Protein spaetzle C-106]; spz
UniProt IDP48607
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: MMTPMWISLFKVLLLLFAFFATYEAKEYERIIKELFTITNDEGVVLFNTSADSAPFMPIPTQHDDPTQKQKQNQNQSPIPETNRHYHQYHSLIQPDQYFKVQRSPNGKLNLVFNDTFVSLQRTDTEVQSEQPIPPRHPSDTFVFPDSPIAKYRPPQSPARPLRNDTKEHNPCAKDESQHLRNFCTNVDDYPDLSGLTHKLKNNFAKFFSNDLQPTDVSSRVGGSDERFLCRSIRKLVYPKKGLRADDTWQLIVNNDEYKQAIQIEECEGADQPCDFAANFPQSYNPICKQHYTQQTLASIKSDGELDVVQNSFKIPSCCKCALKTG.
For Research Use Only | Not For Clinical Use.
Online Inquiry