Mouse Anti-D. melanogaster Taf10 Antibody (CBMOAB-32527FYA)
Cat: CBMOAB-32527FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster) |
| Clone | MO32527FYA |
| Specificity | This antibody binds to fruit fly Taf10. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein (TBP) and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. TAFs may participate in basal transcription, serve as coactivators, function in promoter recognition or modify general transcription factors (GTFs) to facilitate complex assembly and transcription initiation. This gene encodes one of the small subunits of TFIID that is associated with a subset of TFIID complexes. Studies with human and mammalian cells have shown that this subunit is required for transcriptional activation by the estrogen receptor, for progression through the cell cycle, and may also be required for certain cellular differentiation programs. |
| Product Overview | Mouse Anti-D. melanogaster Taf10 Antibody is a mouse antibody against Taf10. It can be used for Taf10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Transcription initiation factor TFIID subunit 10; Transcription initiation factor TFIID 24 kDa subunit; TAFII-24; TAFII24; dTAF(II)24; Taf10 |
| UniProt ID | Q9U5W9 |
| Protein Refseq | The length of the protein is 167 amino acids long. The sequence is show below: MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPLTTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSAQKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLVPALADHGITMRKPQYFV. |
See other products for " TAF10 "
| MO-AB-21228R | Mouse Anti-Cattle TAF10 Antibody (MO-AB-21228R) |
| CBMOAB-44771FYC | Mouse Anti-Arabidopsis TAF10 Antibody (CBMOAB-44771FYC) |
| MO-AB-08239H | Mouse Anti-Frog taf10 Antibody (MO-AB-08239H) |
| CBMOAB-08535FYB | Mouse Anti-Zebrafish taf10 Antibody (CBMOAB-08535FYB) |
| CBMOAB-04370CR | Mouse Anti-Yeast TAF10 Antibody (CBMOAB-04370CR) |
| MO-AB-29332H | Mouse Anti-Rat Taf10 Antibody (MO-AB-29332H) |
| CBMOAB-11870HCB | Mouse Anti-C. elegans TAF10 Antibody (CBMOAB-11870HCB) |
| MO-AB-13373Y | Mouse Anti-O. mykiss TAF10 Antibody (MO-AB-13373Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry