Mouse Anti-D. melanogaster Taf12 Antibody (CBMOAB-32531FYA)
Cat: CBMOAB-32531FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO32531FYA |
Specificity | This antibody binds to fruit fly Taf12. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Control of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene. |
Product Overview | Mouse Anti-D. melanogaster Taf12 Antibody is a mouse antibody against Taf12. It can be used for Taf12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Transcription initiation factor TFIID subunit 12; TAFII30 alpha; Transcription initiation factor TFIID 28-alpha kDa/22 kDa subunits; p28-alpha/p22; Taf12; TAF30-ALPHA |
UniProt ID | P49905 |
Protein Refseq | The length of the protein is 196 amino acids long. The sequence is show below: MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNSNSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTELVREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDVQLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKY. |
See other products for " TAF12 "
CBMOAB-04372CR | Mouse Anti-Yeast TAF12 Antibody (CBMOAB-04372CR) |
MO-AB-21230R | Mouse Anti-Cattle TAF12 Antibody (MO-AB-21230R) |
MO-AB-46750W | Mouse Anti-Horse TAF12 Antibody (MO-AB-46750W) |
CBMOAB-44774FYC | Mouse Anti-Arabidopsis TAF12 Antibody (CBMOAB-44774FYC) |
CBMOAB-11875HCB | Mouse Anti-C. elegans TAF12 Antibody (CBMOAB-11875HCB) |
CBMOAB-08539FYB | Mouse Anti-Zebrafish taf12 Antibody (CBMOAB-08539FYB) |
MO-AB-29334H | Mouse Anti-Rat Taf12 Antibody (MO-AB-29334H) |
MO-AB-65798W | Mouse Anti-Marmoset TAF12 Antibody (MO-AB-65798W) |
MO-AB-13376Y | Mouse Anti-O. mykiss TAF12 Antibody (MO-AB-13376Y) |
MO-AB-21043W | Mouse Anti-Chimpanzee TAF12 Antibody (MO-AB-21043W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry