Mouse Anti-Zebrafish taf12 Antibody (CBMOAB-08539FYB)


Cat: CBMOAB-08539FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO08539FYB
SpecificityThis antibody binds to Zebrafish taf12.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionControl of transcription by RNA polymerase II involves the basal transcription machinery which is a collection of proteins. These proteins with RNA polymerase II, assemble into complexes which are modulated by transactivator proteins that bind to cis-regulatory elements located adjacent to the transcription start site. Some modulators interact directly with the basal complex, whereas others may act as bridging proteins linking transactivators to the basal transcription factors. Some of these associated factors are weakly attached while others are tightly associated with TBP in the TFIID complex. Among the latter are the TAF proteins. Different TAFs are predicted to mediate the function of distinct transcriptional activators for a variety of gene promoters and RNA polymerases. TAF12 interacts directly with TBP as well as with TAF2I. Two transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-Zebrafish taf12 Antibody is a mouse antibody against taf12. It can be used for taf12 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTAF12 RNA polymerase II, TATA box binding protein (TBP)-associated factor; taf12; NP_938182.1;XP_003200277.1;XP_005158367.
UniProt IDQ6P013
Protein RefseqThe length of the protein is 162 amino acids long.
The sequence is show below: MTQYPAQTSRSNFYTVVKAEASSTPPLSSSMANSTVAPGKLPGTPGPAGRLSPEGPQVLSKKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry