Mouse Anti-D. melanogaster Taz Antibody (CBMOAB-32619FYA)


Cat: CBMOAB-32619FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO32619FYA
SpecificityThis antibody binds to fruit fly Taz.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Product OverviewMouse Anti-D. melanogaster Taz Antibody is a mouse antibody against Taz. It can be used for Taz detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTafazzin homolog; dTAZ; Taz
UniProt IDQ9V6G5
Protein RefseqThe length of the protein is 378 amino acids long.
The sequence is show below: MFMVVCSNLRRPGHVGAASAARNINWLISEGYTPPIRAMARPYVQAPEARPVPDERYPGSQQDRKDIATQTVRSSKPKDLRPPSPPTPSQTLNSSSLPPPMSDQDADPSLDVPTGVAMPYNIDWIFPRLRNPSKFWYVVSQFVVSAVGIFSKVVLMFLNKPRVYNRERLIQLITKRPKGIPLVTVSNHYSCFDDPGLWGCLPLGIVCNTYKIRWSMAAHDICFTNKLHSLFFMFGKCIPVVRGIGVYQDAINLCIEKAALGHWIHVFPEGKVNMDKEELRLKWGVGRIIYESPKIPIILPMWHEGMDDLLPNVEPYVIQRGKQVTLNVGQPLDLNDFILDLKKRQVPEPTARKLITDKIQEAFRDLRAETEKLHRERN.
See other products for " TAZ "
MO-AB-65875WMouse Anti-Marmoset TAZ Antibody (MO-AB-65875W)
CBMOAB-08683FYBMouse Anti-Zebrafish taz Antibody (CBMOAB-08683FYB)
MO-AB-38778WMouse Anti-Gorilla TAZ Antibody (MO-AB-38778W)
CBMOAB-59771FYAMouse Anti-Rhesus TAZ Antibody (CBMOAB-59771FYA)
MO-AB-10174YMouse Anti-Rabbit TAZ Antibody (MO-AB-10174Y)
MO-AB-08273HMouse Anti-Frog taz Antibody (MO-AB-08273H)
MO-AB-06429WMouse Anti-Rhesus TAZ Antibody (MO-AB-06429W)
MO-AB-35809WMouse Anti-Ferret TAZ Antibody (MO-AB-35809W)
MO-AB-21624WMouse Anti-Chimpanzee TAZ Antibody (MO-AB-21624W)
MO-AB-43468WMouse Anti-Hamsters TAZ Antibody (MO-AB-43468W)
For Research Use Only | Not For Clinical Use.
Online Inquiry