Mouse Anti-Hamsters TAZ Antibody (MO-AB-43468W)


Cat: MO-AB-43468W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO43468W
SpecificityThis antibody binds to Hamsters TAZ.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
Product OverviewMouse Anti-Hamsters TAZ Antibody is a mouse antibody against TAZ. It can be used for TAZ detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTafazzin; TAZ
UniProt IDG3IBK7
Protein RefseqThe length of the protein is263 amino acids long.
The sequence is show below: MPLHVKWPFPAVPRLTWTIASSVVMGLVGTYSCFWTKYMNQLTVHNKEVLYELIENRGPATPLITVSNHQSCMDDPHLWGILKLRHIWNLKLMRWTPAAADICFTKELHSHFFSLGKCVPVCRGDGVYQKGMDFILEKLNHGDWVHIFPEGKVNMSSEFLRFKWVGIGRLIAECHLPPLTLPLWHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEIRKALTDFIQEEFQRLKMQAEQLHNHFQPGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry