Mouse Anti-D. melanogaster Tim9A Antibody (CBMOAB-33008FYA)


Cat: CBMOAB-33008FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO33008FYA
SpecificityThis antibody binds to fruit fly Tim9A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Tim9A Antibody is a mouse antibody against Tim9A. It can be used for Tim9A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTim9a, isoform B; EC 3.6.3.51; Tim9a
UniProt IDX2JEU5
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKDSEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry