Mouse Anti-D. melanogaster Trh Antibody (CBMOAB-33400FYA)


Cat: CBMOAB-33400FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO33400FYA
SpecificityThis antibody binds to fruit fly Trh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism.
Product OverviewMouse Anti-D. melanogaster Trh Antibody is a mouse antibody against Trh. It can be used for Trh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein trachealess; trh
UniProt IDQ24119
Protein RefseqThe length of the protein is 1022 amino acids long.
The sequence is show below: MLPYQAAVAMDYAGYQRQPTPGHPGSHMATMGSLGMPAVPFTHSWMVPTQDLCAMPPYNKMTGHQQPPGAGMHAQQQPLEPGILELRKEKSRDAARSRRGKENYEFYELAKMLPLPAAITSQLDKASIIRLTISYLKLRDFSGHGDPPWTREASSSSKLKSAAIRRSPAVDLFEQHQGTHILQSLDGFALAVAADGRFLYISETVSIYLGLSQVEMTGSSIFDYIHQADHSEIADQLGLSLTSGGGGGGGSSSSGGGGGGAGGGMASPTSGASDDGSGTHGTNNPDVAASMTQASTSGYKGYDRSFCVRMKSTLTKRGCHFKSSGYRASDATSNCNNGNNASNNAKNVKNPGSNYSVVLLLCKLRPQYTFSHSRKSQPPLLGMVALAIALPPPSVHEIRLECDMFVTRVNFDLRVAHCEPRVSDLLDYSPEDLVNKSLYSLCHAEDANRLRKSHSDLIEKGQVLTGYYRLMNKSGGYTWLQTCATVVCSTKNADEQNIICVNYVISNRENENMILDCCQLEPSPDSIKHEEGLGNDKSSGSPGGDASGEGNSHLSAGDMKLNSPKTDSEGHSHRGRGRSAAASHGSSMNSLTMIKDSPTPLGVEIDSGVLPTTVATPVPAATPPVQSTKRKRKTKASQHAEDQGQEQVISEQPLPKLPTMEQRDQQPRSRLPSIVDEQPSSAADSAVKDLEQAMSKHLPSPAAVVSVAPPNTDFSADSLLKQQQQQQQLDPNEKSSTIQWIGTPYQQPPAPMPATALLRQLYANRESVIRATARQTPTGVGPGVFYGDQQTGPLPTPPGSESSYENQYLQLHSAASGGHPGGQKTSADAFTNLVSTYGGYHSSIDYHNAMTPPSSVSPRDSNQPGKAAPVLASNGGYDYAPDPLRGQYATSSGDVVPATLPLKPQASYTATMHPSGSTTTEGGVTYSNLDQPQYFAPHSSFHLYHKGSPASGWYSTPSXVVDDQGQVPPSCQDQYHHHHHHHHHQDGSAGSSASQASERWDFVGALGKVARMFFSARKGNPG.
For Research Use Only | Not For Clinical Use.
Online Inquiry